SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7J9Z5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7J9Z5
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily TIMP-like 6.36e-27
Family The laminin-binding domain of agrin 0.0000289
Further Details:      
 
Domain Number 2 Region: 390-457
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 2.5e-16
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 3 Region: 169-239
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000263
Family Ovomucoid domain III-like 0.005
Further Details:      
 
Domain Number 4 Region: 93-163
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000541
Family Ovomucoid domain III-like 0.0045
Further Details:      
 
Domain Number 5 Region: 529-587
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000134
Family Ovomucoid domain III-like 0.0065
Further Details:      
 
Domain Number 6 Region: 474-523
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000139
Family Ovomucoid domain III-like 0.0057
Further Details:      
 
Domain Number 7 Region: 623-671
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000125
Family Ovomucoid domain III-like 0.0039
Further Details:      
 
Domain Number 8 Region: 254-310
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000018
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 9 Region: 715-757
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000865
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 10 Region: 320-382
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000554
Family Ovomucoid domain III-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0S7J9Z5
Sequence length 814
Comment (tr|A0A0S7J9Z5|A0A0S7J9Z5_9TELE) AGRIN {ECO:0000313|EMBL:JAO61235.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=AGRIN OC=Poeciliinae; Poeciliopsis.
Sequence
SLLDGGNKVTIGGFGNPRICDNQVATGDTRIFFLNLTPESVGPDHKNELMLNSSLMRITL
RNLEEVEHCVEAHKYIIADKPSHFTPAQPPDGCRGMLCGFGAVCERNPTDPSKGECVCKK
LDCPSLVAPVCGSDTSTYSNECELEKAQCNTQRRIKVQRKGPCSLKNPCAEVTCSYGSTC
VQSSDGLSAKCMCPLSCDGKPNQMVCGSDGKDYRNECELHQQACKNQKNIRVQFQGPCDP
CKDSENSLNTICRVQAVTRQPQLYRPPESCRPESEPLCASDGHTYLSECAMMATGVQKGI
SLRKIHAGACRKSETCREDCLFNAVCVVEQSGARCSCDPIECDDTYKPLCSVDGRTFPNN
CLRRKAECLSKSLIRTKQPGPCDLNALSPCLTKTCTHGAMCVVKNNEPVCECTEACTLTS
DPVCGSDGQSYRSPCEMRAMGCTLQRDIRIQHKGPCDEACSNCSFGAICDAQSGRCVCPS
ECVESHQPVCGSDGHTYHSECELNVRSCMEQVELRVVSQGECKMCGNTVCSFGAQCVERK
CECLQCSGEASAPVCGSDGITYSNECELNRSACEHKRKIDVAKHGSCEEECGSGASGSGL
ESCEQERCMMYDGIWNEDEEDERCICSFNCESVPLNEVCGSDGKTYRNECELKNTKCLER
RLLLIQSQGPCAENYVTSPTELTAPQHCGLSPYGCCSDNITAALGLGQAGCPSTCQCNVH
GSYKGSCDPTSGQCSCKPGVGGQKCDRCEPGFWNFRAIITEGMSGCTRKEPLLVSIYMMH
VVEEAESTQNIRVSKPRRFRLMLVRSVLYFQIPF
Download sequence
Identical sequences A0A0S7J9Z5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]