SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7JLY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7JLY4
Domain Number 1 Region: 7-169
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 4.05e-65
Family Substrate-binding domain of HMG-CoA reductase 0.000000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0S7JLY4
Sequence length 193
Comment (tr|A0A0S7JLY4|A0A0S7JLY4_9TELE) HMDH {ECO:0000313|EMBL:JAO65373.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=HMDH OC=Poeciliinae; Poeciliopsis.
Sequence
RPLHAINWILGRGKSAVCEATIPAKVVREVLKSSTAALVDLNISKNLVGSAVAGSIGGFN
AHAANIVTAIFIACGQDPAQTVGSSSCITQMEAVGPDADDLYISCTMPSIEVGTVGGGTN
LPPQQACLQMLGVAGPNQPGENGRQMARVVCATVLAGELSLMAALAAGHLVKSHMTHNRS
KTNLAAETNGPKR
Download sequence
Identical sequences A0A0S7JLY4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]