SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7JYT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7JYT8
Domain Number 1 Region: 118-239
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-34
Family cAMP-binding domain 0.00000112
Further Details:      
 
Domain Number 2 Region: 247-371
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.17e-32
Family cAMP-binding domain 0.000000866
Further Details:      
 
Domain Number 3 Region: 14-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.54e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0S7JYT8
Sequence length 380
Comment (tr|A0A0S7JYT8|A0A0S7JYT8_9TELE) KAP1 {ECO:0000313|EMBL:JAO69954.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=KAP1 OC=Poeciliinae; Poeciliopsis.
Sequence
MATSSSALEEDESLKGCEIFVQKHNIQQILKECIVNLCIAKPERPMKFLREHFEKLEKEE
CKQIMARQKSNSQSDSHDDEVSPPPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKD
YKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQGE
VDVYVNGELVTNIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLR
KRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGIAS
VLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGP
CSEILKRNIQRYNSFISLTV
Download sequence
Identical sequences A0A0S7JYT8
XP_007556470.1.10163 XP_014839112.1.96476 XP_014881490.1.100837 XP_015246709.1.42780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]