SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7LKR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7LKR2
Domain Number 1 Region: 71-224
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000000116
Family RUN domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S7LKR2
Sequence length 237
Comment (tr|A0A0S7LKR2|A0A0S7LKR2_9TELE) RUSC1 {ECO:0000313|EMBL:JAO89993.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=RUSC1 OC=Poeciliinae; Poeciliopsis.
Sequence
MREEMKERKTEKGKEEVEVRGRADGGRTIESRTSAVRSVSFAGSVQKIDVPWMGEDAEHS
VRGLGLTSLCMQEKKALVSGASAAVEAILAQFSSSRTIVQKALSGDSAINPSLGRLVLQC
LCPALHNLLTDGLKPHQSDLIAGRRPNSAWSLVQATTRTGPKTQALFNLQIRVGELPQLR
HSKQRFNAFLLGLLNTKLLDFWLCHLQSCSDVLEAYYHPTSFMRLSLTTCWPLFEGR
Download sequence
Identical sequences A0A0S7LKR2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]