SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S8EQ37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S8EQ37
Domain Number 1 Region: 150-259
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.00000000000644
Family Marine metagenome family DABB3 0.081
Further Details:      
 
Domain Number 2 Region: 33-142
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.00000000912
Family NIPSNAP 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0S8EQ37
Sequence length 260
Comment (tr|A0A0S8EQ37|A0A0S8EQ37_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KPK50664.1} KW=Complete proteome; Reference proteome OX=1704028 OS=Planctomycetes bacterium SM23_25. GN=AMK72_01630 OC=Bacteria; Planctomycetes.
Sequence
MQRREFLGAVGVAGAAAMGAAAETARAAGAPKKQYLELRLYSCDAGAMREGLETFLGKAA
IPAWNRAGIKPVGVFGLTEPPSADLYVLLPHESIESFAEAPHRVWADAAYQKDGAALLDT
PKKEPPYKRIESSLMLAFDGIPKVEVPATKDTRVFQLRTYESHCAERAMRKIEMFNTGGE
LALFRRTGMNPVFFGQSLVGPKLPNLTYMLGFDDMEAKDAAWKTFGDHPEWKTIRSDPKY
KDTVSNITNLMLRPAACSQI
Download sequence
Identical sequences A0A0S8EQ37

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]