SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S8F7N3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S8F7N3
Domain Number 1 Region: 5-90
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 3.01e-19
Family DNA polymerase beta, N-terminal domain-like 0.0029
Further Details:      
 
Domain Number 2 Region: 96-152
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000000763
Family ComEA-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0S8F7N3
Sequence length 293
Comment (tr|A0A0S8F7N3|A0A0S8F7N3_9GAMM) DNA-binding protein {ECO:0000313|EMBL:KPK56510.1} KW=Complete proteome; Reference proteome OX=1703405 OS=Gammaproteobacteria bacterium SG8_31. GN=AMJ59_22135 OC=Bacteria; Proteobacteria; Gammaproteobacteria.
Sequence
MASVLNKQIAEKLDEMAELLEVQGANPFRVRAYRRAAATVGEMDRDLEEISRSEGMEGLV
SLPTVGKGIAAAVWEMVHTGRWSQLERLRGSLQPENLLQTVPGIGPALAKRIHDDLHVDT
LEELETAAFDGRLEGLPGIGSRKLQALRATLATMLGRARRTSGRTGADGPSVATLLRIDR
DYRKGATEGSLPRIAPKRFNPEGEAWLPILHADRDGWHFTALFSNTARAHELDKVYDWVV
LYFYNEDHEEGQHTVVTETRGPLQGRRVVRGREAECRELYSKSESPADRESTA
Download sequence
Identical sequences A0A0S8F7N3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]