SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S8G6Z9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S8G6Z9
Domain Number 1 Region: 3-140
Classification Level Classification E-value
Superfamily MTH1598-like 5.75e-36
Family MTH1598-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S8G6Z9
Sequence length 140
Comment (tr|A0A0S8G6Z9|A0A0S8G6Z9_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KPK68608.1} KW=Complete proteome OX=1703774 OS=candidate division TA06 bacterium SM23_40. GN=AMJ82_07790 OC=Bacteria; candidate division TA06.
Sequence
MGSYEVLEHTADLSLTIHGTTLEDLFATAARAMFECLVDIGSISASVEMDIHVVNGDEGV
EELLVEWLRELLYRLATDEMLFCRFDIGRLSDREVVARCAGELVDPERHRLRTEIKSVTY
HDLEVRQEPRGWVAHVLFDI
Download sequence
Identical sequences A0A0S7WRT0 A0A0S8G6Z9 A0A0S8JM79

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]