SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S8HZP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S8HZP0
Domain Number 1 Region: 81-286
Classification Level Classification E-value
Superfamily Methenyltetrahydrofolate cyclohydrolase-like 3.66e-58
Family Methenyltetrahydrofolate cyclohydrolase-like 0.0000744
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily Formiminotransferase domain of formiminotransferase-cyclodeaminase. 0.00000000173
Family Formiminotransferase domain of formiminotransferase-cyclodeaminase. 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S8HZP0
Sequence length 287
Comment (tr|A0A0S8HZP0|A0A0S8HZP0_9BACT) Formiminotransferase-cyclodeaminase {ECO:0000313|EMBL:KPK90736.1} KW=Complete proteome; Reference proteome OX=1703762 OS=bacterium SM23_31. GN=AMJ80_08015 OC=Bacteria.
Sequence
ARRLAAERGVVVTGSEIVGMVPYPALLETGKYYLKKQGRSAGVPVRDILETAVQSLGLRD
VADFKIEERVLGLPRNTDSALVEMKVTDFVDEVSRESPAPGGGSIAALAGALGASLASMV
SNLTANKPGSGEIDAVLNEAAEKLQEIKFALIKGVDDDANAFNSYMEARRLPQKTEEEKK
ARYEAMQNGLKQAVFVPLNTAKLSLKAIEIAETVVKYGNPNSISDAGVGAQAAFAGVKGG
IYNVLINLRDIEDDRFNNDMRQQCEALEKEARKRLDKIDKQVEGMIK
Download sequence
Identical sequences A0A0S8HZP0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]