SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S8IYM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S8IYM1
Domain Number 1 Region: 141-197
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000118
Family Type I dockerin domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S8IYM1
Sequence length 204
Comment (tr|A0A0S8IYM1|A0A0S8IYM1_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KPL02352.1} KW=Complete proteome; Reference proteome OX=1703424 OS=candidate division Zixibacteria bacterium SM1_73. GN=AMJ73_08840 OC=Bacteria.
Sequence
MKMENNGFKLGALVFCLLLLASVGFADKGKKALPSKATIVKENLKQLSQKEQPAVEIKPV
KLPETPLLSPSAADDKGKQMKWQVVSSGAEEGGTSVTFQLGRNPGYVLSGTVGQLAVGGG
SSDSYNMNSGYWQSFEECAGRGDANGDGVINSADIVYLINYLFKSGPEPVPLCTGDVNCD
DVINSADVVYLINYLFKGGPPPGC
Download sequence
Identical sequences A0A0S8IYM1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]