SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T5PN87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0T5PN87
Domain Number - Region: 12-96
Classification Level Classification E-value
Superfamily ARM repeat 0.0345
Family PBS lyase HEAT-like repeat 0.033
Further Details:      
 
Domain Number - Region: 159-206
Classification Level Classification E-value
Superfamily STAT 0.0471
Family STAT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0T5PN87
Sequence length 221
Comment (tr|A0A0T5PN87|A0A0T5PN87_9ALTE) Phage-shock protein {ECO:0000313|EMBL:KRS22642.1} KW=Complete proteome OX=1651088 OS=Alishewanella sp. WH16-1. GN=AAY72_02290 OC=Alteromonadaceae; Alishewanella.
Sequence
MGIFSRFSDIVNSNINALLDKAEDPEKMVRLIIQEMEDTLVEVRSSSAKTIAEKKELQRL
ITRLQEEATDWQAKAELALSKERDDLARSALIERQKAAEQAETVARDIANLDEHISKLQD
EVTQLQEKLADAKARQKSMLMRRQTVANRLEVKKTLDSNKINDAMYKFERYEQKIDTLEA
QVEAYDLGKKSLKDEFAELAAQDKIDQELAELKAKMQNKDA
Download sequence
Identical sequences A0A0T5PN87 A0A259NYN2 I9DUB2
WP_008984186.1.14482 WP_008984186.1.87145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]