SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T5ZE38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0T5ZE38
Domain Number 1 Region: 3-49
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000000000536
Family AN1-like Zinc finger 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0T5ZE38
Sequence length 75
Comment (tr|A0A0T5ZE38|A0A0T5ZE38_9ARCH) AN1-type Zinc finger protein {ECO:0000313|EMBL:KRT61009.1} KW=Complete proteome; Reference proteome OX=1640512 OS=Thaumarchaeota archaeon CSP1-1. GN=XU09_C0007G0116 OC=Archaea; Thaumarchaeota; unclassified Thaumarchaeota.
Sequence
MKPANCAYCGDLQDMPFQCNYCKDPFCAEHRLPEDHRCVKLTQIRAKKFGQSGVVRDGGR
NKGSFFKRLFRKSKN
Download sequence
Identical sequences A0A0T5ZE38

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]