SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T5ZHP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0T5ZHP2
Domain Number 1 Region: 41-133
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000248
Family TSP type-3 repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 180-262
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000719
Family TSP type-3 repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0T5ZHP2
Sequence length 308
Comment (tr|A0A0T5ZHP2|A0A0T5ZHP2_9ARCH) Autotransporter adhesin {ECO:0000313|EMBL:KRT62102.1} KW=Complete proteome; Reference proteome OX=1640512 OS=Thaumarchaeota archaeon CSP1-1. GN=XU09_C0001G0164 OC=Archaea; Thaumarchaeota; unclassified Thaumarchaeota.
Sequence
MKGMARWNKVEQSSIIVVLLLTVSFSNLAFAQENTTENEIPPADTDGDGIADTTDQCINE
AETMNGYQDEDGCPDTVPVQDTDNDGIADDSDGCPTQAETVNGFEDLDGCPDVIPLKDTD
GDGITDSLDKCPTQIETVNGFEDLDGCPDVTPIGDLDKDGIADSLDKCPTQEETVNGVED
TDGCPDLVTVRDSDGDGIINTEDQCPRDGETFNSFQDTDGCPDVLPDTDKDDDNIIDTID
KCPTQTETMNGFEDSDGCPDTPPVNVIEGNQVEEKGADNSGLYQWAAVIAAGITAAGSIA
AAKYRKHG
Download sequence
Identical sequences A0A0T5ZHP2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]