SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T6BGR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0T6BGR7
Domain Number 1 Region: 37-179
Classification Level Classification E-value
Superfamily PH domain-like 6.46e-41
Family Third domain of FERM 0.000000654
Further Details:      
 
Domain Number 2 Region: 323-405
Classification Level Classification E-value
Superfamily Moesin tail domain 6.54e-28
Family Moesin tail domain 0.0001
Further Details:      
 
Domain Number 3 Region: 3-39
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000366
Family Second domain of FERM 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0T6BGR7
Sequence length 405
Comment (tr|A0A0T6BGR7|A0A0T6BGR7_9SCAR) FERM domain containing protein {ECO:0000313|EMBL:KRT86363.1} KW=Complete proteome; Reference proteome OX=1629725 OS=Oryctes borbonicus. GN=AMK59_1022 OC=Scarabaeiformia; Scarabaeidae; Dynastinae; Oryctes.
Sequence
MSKTEWEQSIMTWWHEHRGMLREDAMMEYLKIAQDLEMYGVNYFDIRNKKGTELYLGVDA
LGLNIYEKDDRLTPKIGFPWSEIRNISFNERKFIIKPIDKKAPDFVFFAPRVRINKRILA
LCMGNHELYMRRRKPDTIDVQQMKAQARDEKLAKQQQREKLQLEIAARERAEKKQQEYMD
KLKQMEEEMNRSQASLQEAQEMIRRLEEQLKQLQAAKDEHEKKQMELQEMMMRLEETKNM
EAAERQKLEEEILAKQEEVMRIQEEVEAKDNETKRLQEEVEAARSKAEELRAQQLANATK
GHLEENQHDEDDEVVNGDISKDLDTDENIVDPVEDRKTLAERNERLQDQLLALKQDLAQS
RDETKETPMDKIHRENVRQGRDKYKTLREIRKGNTKRRVDQFENM
Download sequence
Identical sequences A0A0T6BGR7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]