SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T6UWS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0T6UWS3
Domain Number 1 Region: 25-157
Classification Level Classification E-value
Superfamily Ecotin, trypsin inhibitor 4.05e-50
Family Ecotin, trypsin inhibitor 0.0000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0T6UWS3
Sequence length 158
Comment (tr|A0A0T6UWS3|A0A0T6UWS3_9PSED) Ecotin {ECO:0000313|EMBL:KRW62459.1} KW=Complete proteome; Reference proteome OX=1729724 OS=Pseudomonas sp. TTU2014-080ASC. GN=AO726_03275 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MYEFNKAFASMICSLPLMACAATPDALKPYPAPAEGYTRHVIDLPVLDNEGDHKVEILAG
KTMEVDCNVRRLGGQWQEKTAEGWGYTYYELSEVGPGISTMMGCLNNELKKAFVQAGGEP
KLVRYNSKLPIVVYTPADVEVHYRIWSAKPESTVAKQQ
Download sequence
Identical sequences A0A0T6UWS3
WP_058066613.1.65654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]