SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T7NSP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0T7NSP1
Domain Number 1 Region: 4-138
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase II 8.89e-30
Family Peptidyl-tRNA hydrolase II 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0T7NSP1
Sequence length 138
Comment (tr|A0A0T7NSP1|A0A0T7NSP1_YEREN) Uncharacterized protein conserved in bacteria {ECO:0000313|EMBL:CFQ33852.1} KW=Complete proteome OX=630 OS=Yersinia enterocolitica. GN=ERS008498_01684 OC=Yersiniaceae; Yersinia.
Sequence
MTEQMRIAIIVNPELPVGLIANTTSAVGIGLAARFPQLAGAVLSDSEGKEIDVSSKLPVP
ILQANASQMREVLLKALAATHERAIVPFPAFARSMHSFEDYEATFPLRSLTNEQLDGLGL
VGPEKWVRSLTGALKLLR
Download sequence
Identical sequences A0A0T7NSP1
WP_072188450.1.47260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]