SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T8JGC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0T8JGC9
Domain Number - Region: 13-76
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 0.0127
Family MOSC N-terminal domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0T8JGC9
Sequence length 77
Comment (tr|A0A0T8JGC9|A0A0T8JGC9_STREE) Uncharacterized protein {ECO:0000313|EMBL:CJJ27523.1} KW=Complete proteome OX=1313 OS=Streptococcus pneumoniae. GN=ERS021189_00820 OC=Streptococcus.
Sequence
MMKVLLLGDIANRWAVSVERVQELVQIDPLFPGPYIILPSKDALYLEMDITEYEQLHAEL
TQVYIRGRNLRAFLRGE
Download sequence
Identical sequences A0A0D0R9Y2 A0A0D0RGT5 A0A0F6J2Q4 A0A0T8JGC9 A0A164Y6H3 A0A1B1L0Z2 A0A1H6DDV0 A0A1I4MZN1 A0A1M6P1Y2 A0A1M7CBN5 A0A2A9HZS4 C2UA03 C3DZC2 J8ENN5 J8JHD4 J8L6W3 J8L9L2 J8NWB8 J8RJX8 J8Y3U4 M1QGS2 R8DP47 R8FJ94 R8FXC8 R8GMH3 R8GXK1 R8KIC7 S3J6D0
gi|296501483|ref|YP_003663183.1| gi|452197101|ref|YP_007477182.1| WP_002025339.1.4447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]