SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T8PYV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0T8PYV5
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily MbtH-like 7.32e-29
Family MbtH-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0T8PYV5
Sequence length 69
Comment (tr|A0A0T8PYV5|A0A0T8PYV5_STREE) Uncharacterized protein conserved in bacteria {ECO:0000313|EMBL:CJS44418.1} KW=Complete proteome OX=1313 OS=Streptococcus pneumoniae. GN=ERS021733_03711 OC=Streptococcus.
Sequence
MANPFENADGTYLVLINEEGQYSLWPGFIDVPSGWTVVHEQKGREACLDYIQSHWSDMRP
NSLKTVENV
Download sequence
Identical sequences A0A0T8PYV5 A0A1X7CU91 A0A1Y0X1W3 A0A285JP63 A0A2J6DPN0 G4ERQ1
gi|384176791|ref|YP_005558176.1| WP_003228753.1.100042 WP_003228753.1.11231 WP_003228753.1.11581 WP_003228753.1.19261 WP_003228753.1.21045 WP_003228753.1.2546 WP_003228753.1.27372 WP_003228753.1.27612 WP_003228753.1.27660 WP_003228753.1.31100 WP_003228753.1.31786 WP_003228753.1.39562 WP_003228753.1.42762 WP_003228753.1.43852 WP_003228753.1.44140 WP_003228753.1.47672 WP_003228753.1.5262 WP_003228753.1.52860 WP_003228753.1.54596 WP_003228753.1.57184 WP_003228753.1.63795 WP_003228753.1.71916 WP_003228753.1.72516 WP_003228753.1.78811 WP_003228753.1.79046 WP_003228753.1.79288 WP_003228753.1.79712 WP_003228753.1.80832 WP_003228753.1.84183 WP_003228753.1.84556 WP_003228753.1.88591 WP_003228753.1.89000 WP_003228753.1.9164 WP_003228753.1.99399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]