SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T8XFR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0T8XFR6
Domain Number 1 Region: 21-211
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 9.81e-58
Family MW0975(SA0943)-like 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0T8XFR6
Sequence length 220
Comment (tr|A0A0T8XFR6|A0A0T8XFR6_STREE) Putative cell-wall binding lipoprotein {ECO:0000313|EMBL:CKF77082.1} KW=Complete proteome OX=1313 OS=Streptococcus pneumoniae. GN=ERS232524_01594 OC=Streptococcus.
Sequence
MLKYSKLAIVTALSMILLAGCFGPKPEEELYVAFENAAKQEKTMFEDAKKLETLEKEGQE
LYNQIVQEGKDNNQTVKEKLNQAVKNTTEREKVLAKEKEVLNKAQEEVKSADKYVKKIED
KKLKDQADKVKSTYEKRHDSFNKMYDSYDKSLKQEKELYTMLQDKGTKLKDISEKVKVVN
QSYKDIESEKDKFNQFTKSYNTEKVAFYKQANIKIKEEKK
Download sequence
Identical sequences A0A0T8XFR6
WP_087875690.1.74302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]