SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T9AJ26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0T9AJ26
Domain Number 1 Region: 55-137
Classification Level Classification E-value
Superfamily Cell wall binding repeat 2.88e-28
Family Cell wall binding repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 3-57
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000159
Family Prokaryotic proteases 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0T9AJ26
Sequence length 138
Comment (tr|A0A0T9AJ26|A0A0T9AJ26_STREE) Serine protease {ECO:0000256|RuleBase:RU004296} KW=Complete proteome OX=1313 OS=Streptococcus pneumoniae. GN=ERS096208_02348 OC=Streptococcus.
Sequence
MDYQVDTLEGSSGSTVYDASHRVVGVHTLGDGANQINSAVKLNERNLPFIYSVLKGYSLE
GWKKINGSWYYYRQHDKQTGWQEINDTWYYLDSSGKMLTDWQKVNGKWYYLNSNRAMVTG
SQTIDGKVYNFASSGEWI
Download sequence
Identical sequences A0A0T9AJ26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]