SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T9K068 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0T9K068
Domain Number 1 Region: 11-189
Classification Level Classification E-value
Superfamily VC0467-like 2.88e-45
Family VC0467-like 0.0000695
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0T9K068
Sequence length 195
Comment (tr|A0A0T9K068|A0A0T9K068_MYCTX) UPF0301 protein ERS075342_00371 {ECO:0000256|HAMAP-Rule:MF_00758} OX=1773 OS=Mycobacterium tuberculosis. GN=ERS075342_00371 OC=Mycobacterium; Mycobacterium tuberculosis complex.
Sequence
MMEPMEDGIRVGLLLVATPQLEDPNFRRSVVLLVEHDAGGGTLGVVLNRPTEVPVDRVLP
PWGDLATGPAVVFQGGPVALEHPLALARLPGEDEPLGWRALDGGAEVARVGVVDLEAPPG
LLAAELLQLRVFAGYAGWSAGQLLGEIQDGSWYLVPAEAGDVFAAAPERLWQDVLRRQGG
DLAFVSTFPDDPTLN
Download sequence
Identical sequences A0A0T9K068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]