SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T9L805 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0T9L805
Domain Number 1 Region: 88-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000209
Family NfeD domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0T9L805
Sequence length 149
Comment (tr|A0A0T9L805|A0A0T9L805_YERKR) Putative activity regulator of membrane protease YbbK {ECO:0000313|EMBL:CNE66294.1} KW=Complete proteome OX=28152 OS=Yersinia kristensenii. GN=ERS008491_01915 OC=Yersiniaceae; Yersinia.
Sequence
MLEAIAANPSWFWLSLGGLLLAAEMLGASGYMLWSGVAAVVVGALVWLFPFSWEMQGVLF
AVLTVVSAFLWWYWLSKRTKPQPAMLNQRTHQLLGTRATLTEPTVDGFGRMKVGDSSWRI
YSANELAIGTEVEVILVEGNTLHVRAIHH
Download sequence
Identical sequences A0A0T9L805
WP_050096164.1.100200 WP_050096164.1.2833 WP_050096164.1.5946 WP_050096164.1.81200 WP_050096164.1.97152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]