SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T9PYM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0T9PYM0
Domain Number 1 Region: 7-71
Classification Level Classification E-value
Superfamily MbtH-like 3.79e-28
Family MbtH-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0T9PYM0
Sequence length 76
Comment (tr|A0A0T9PYM0|A0A0T9PYM0_9GAMM) Uncharacterized protein conserved in bacteria {ECO:0000313|EMBL:CNH86626.1} KW=Complete proteome OX=419257 OS=Yersinia massiliensis. GN=ERS008670_01814 OC=Yersiniaceae; Yersinia.
Sequence
MSHEAQVNPFDNEELPFLVLINEQQQYSLWPQITAIPAGWTSVYGPQSRADCVKYLEANW
TDMRPASLIRAEAALR
Download sequence
Identical sequences A0A0H5LQ10 A0A0T9PYM0
WP_049606610.1.42082 WP_049606610.1.53956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]