SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T9SL88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0T9SL88
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily VC0467-like 1.83e-55
Family VC0467-like 0.0000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0T9SL88
Sequence length 168
Comment (tr|A0A0T9SL88|A0A0T9SL88_YEREN) UPF0301 protein ERS137951_02976 {ECO:0000256|HAMAP-Rule:MF_00758} KW=Complete proteome OX=630 OS=Yersinia enterocolitica. GN=ERS137951_02976 OC=Yersiniaceae; Yersinia.
Sequence
MRSVIYICEHNKEGAMGLVINKPMEQFTVETVLKKLKISPTPRDPSIRLDKAVLAGGPLA
EDRGFILHSPQEGFGSSIPISPDTMITTSKDVLETLGTPEQPKNLLVALGYAGWQQGQLE
QELLDNAWLTIEADTHILFNTPIAERWQAAANKLGINIFNIAPQAGHA
Download sequence
Identical sequences A0A0T9SL88

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]