SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0T9XUJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0T9XUJ5
Domain Number 1 Region: 2-210
Classification Level Classification E-value
Superfamily Thermostable phytase (3-phytase) 6.54e-25
Family Thermostable phytase (3-phytase) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0T9XUJ5
Sequence length 213
Comment (tr|A0A0T9XUJ5|A0A0T9XUJ5_SALET) Outer membrane protein {ECO:0000313|EMBL:CNU91094.1} KW=Complete proteome OX=58097 OS=Salmonella enterica subsp. enterica serovar Bovismorbificans. GN=ERS008198_03860 OC=Enterobacteriaceae; Salmonella.
Sequence
MTDHPSSVVELDTEGNVLRVIPSDGDHDFEAIEYLGGNRYALSRERERTLTTHCIDSSTT
VLPPATYSLTLDVDRHSDNAGFEGLARGRGEHALMVAQEKKPLRLYVTDRSPDALSVSDS
LTHRASLPWFLKDISGLHYDRNNGLLYVLSHESAVVVVSDLDGGRKVMSLRRGHCGLRRD
IPQAEGIASDDRDTLWIVSEPNLFYRFTRTAAS
Download sequence
Identical sequences A0A0T9XUJ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]