SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U0FBL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0U0FBL1
Domain Number 1 Region: 34-300
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 4.58e-58
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000762
Further Details:      
 
Weak hits

Sequence:  A0A0U0FBL1
Domain Number - Region: 9-38
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0942
Family Trimerization domain of TRAF 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0U0FBL1
Sequence length 314
Comment (tr|A0A0U0FBL1|A0A0U0FBL1_STREE) Methyl-accepting chemotaxis protein 1 {ECO:0000313|EMBL:COE54511.1} KW=Complete proteome OX=1313 OS=Streptococcus pneumoniae. GN=ERS020515_02135 OC=Streptococcus.
Sequence
MFTQKKSLQHKIDQLENRIQELEAELKQKDIEQQETISSIHDRVQSVVQEHKLVNNQHHT
LQNLVQQLNSCFENVSTRTTHSNELNNEMLQKEQSLIQSIEEIIDCSNEGKESVHRLLIV
INKLGEQSQRTSNSMNHLSERSKEIEQIVEVIQNIAAQTNLLALNASIEAARAGEHGKGF
AVVANEVRKLAESTAESTKNIGNLTKKIQEEIEKAYDNTKDNLHLVDEGVEMSADTNARI
ENILIMIQTLQNGATNVIKAIENQKSCNDDILREFANTQQMFQKLNTTIMNHIHDAEKVD
VQLTKSLEETVVSH
Download sequence
Identical sequences A0A0U0FBL1 A0A1N7V5R3 A0A2B6CH74 B7JQG7 C2TBY3 C3FYH8
WP_000495010.1.16013 WP_000495010.1.29804 WP_000495010.1.34158 WP_000495010.1.45385 WP_000495010.1.45919 WP_000495010.1.56580 WP_000495010.1.60841 WP_000495010.1.63137 WP_000495010.1.66331 WP_000495010.1.7545 WP_000495010.1.90155 WP_000495010.1.94373 405535.BCAH820_0739 gi|218901878|ref|YP_002449712.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]