SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U0Z2A9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0U0Z2A9
Domain Number 1 Region: 19-139
Classification Level Classification E-value
Superfamily BH3703-like 3.4e-18
Family BH3703-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0U0Z2A9
Sequence length 142
Comment (tr|A0A0U0Z2A9|A0A0U0Z2A9_9MYCO) Uncharacterized protein {ECO:0000313|EMBL:CPU62655.1} KW=Complete proteome OX=36809 OS=Mycobacterium abscessus. GN=ERS075557_04840 OC=Mycobacterium.
Sequence
MTDEAPYLVREGQLEQEAVKWLYYNLPENDWESCYLEFRKAGPIAEAVVKYTRPNGDVEP
FSPPSKLIDSLMDLREFMATLGKGAWLSLRLELTKDAKYSFKYNYDERPNWLAPVDDEAY
VIDLQKFPRPPEAIPAWYPRAN
Download sequence
Identical sequences A0A0U0Z2A9
WP_052541171.1.12695 WP_052541171.1.71775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]