SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U1HV53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0U1HV53
Domain Number 1 Region: 158-261
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000196
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Weak hits

Sequence:  A0A0U1HV53
Domain Number - Region: 46-81
Classification Level Classification E-value
Superfamily HR1 repeat 0.00497
Family HR1 repeat 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0U1HV53
Sequence length 269
Comment (tr|A0A0U1HV53|A0A0U1HV53_YERRO) Cell division coordinator CpoB {ECO:0000256|HAMAP-Rule:MF_02066} KW=Complete proteome OX=29485 OS=Yersinia rohdei. GN=ERS008555_02765 OC=Yersiniaceae; Yersinia.
Sequence
MNSNFRRHLVGLSLLVGVAVPWAATAQAPISNVGSGSVEDRVTQLERISNAHSQLLTQLQ
QQLSDSQRDVDSLRGQIQENQYQLNQIVERQKQIYQQMESLSGGQGASTSTPAAAGAATD
SAATGSSDTAAAGAAAATAAPAASTGDENSDYNAAVSLALEKKQYDQAITAFQSFVKQYP
KSTYQPNANYWLGQLYYNKGKKDDAAYYYAVVVKNYPKSPKSSEAMFKVGVIMQDKGQSD
KAKAVYQQVIKQYPTTDAAKQAQKRLSAL
Download sequence
Identical sequences A0A0U1HV53
WP_004715791.1.16280 WP_004715791.1.19887 WP_004715791.1.30678 WP_004715791.1.43404 WP_004715791.1.46275 WP_004715791.1.70144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]