SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U1KZF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0U1KZF7
Domain Number - Region: 29-82
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 0.0732
Family Substrate-binding domain of HMG-CoA reductase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0U1KZF7
Sequence length 307
Comment (tr|A0A0U1KZF7|A0A0U1KZF7_9FIRM) von Willebrand factor type A domain protein, associated with Flp pilus assembly {ECO:0000313|EMBL:CQR72798.1} KW=Complete proteome; Reference proteome OX=411922 OS=Sporomusa sp. An4. GN=SpAn4DRAFT_3258 OC=Sporomusa.
Sequence
MRIFVVNQKGSITVLTVLAITVLLGFAALVVDVGFLYVNRAELVNMADAAALAGVQDLPG
DTAQAEASGREYAAQNGQSGDVIEVIVPTNRAVAVSVKRTVNMVFAKVFGLNSVDVRAKS
AAVLRPTSGVIGVVPFGVVWQEFVYGTTYALKVGAGDGYAGNYDALALGGTGSRTYTDNI
KFGYDAKLSIGQWVSTETGNMSGGTGEGVNYRIGLDPYATFNTVEAGSPRIIIVPLIESI
TNDTGRHDVKIVGFAGFFLEGVAGSGNENLVSGKFMQTVIAGETSGTAINYGVYSAALVP
YESVAAN
Download sequence
Identical sequences A0A0U1KZF7
WP_021168485.1.45728 WP_021168485.1.5522 WP_021168485.1.55283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]