SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U1QTQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0U1QTQ4
Domain Number - Region: 8-45
Classification Level Classification E-value
Superfamily Rabenosyn-5 Rab-binding domain-like 0.034
Family Rabenosyn-5 Rab-binding domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0U1QTQ4
Sequence length 66
Comment (tr|A0A0U1QTQ4|A0A0U1QTQ4_YERP3) Uncharacterized protein {ECO:0000313|EMBL:ABS45763.1} KW=Complete proteome OX=349747 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758). GN=YpsIP31758_B0054 OC=Yersiniaceae; Yersinia.
Sequence
MLHIADYPQMKQIAWYLKDDAELDEREALAFYERNWKYVEPEALEPHEKALIEKLVQEYG
GGILNV
Download sequence
Identical sequences A0A0U1QTQ4
WP_011988607.1.58543 349747.YpsIP31758_B0054 gi|153930760|ref|YP_001393352.1|NC_009705 gi|153930760|ref|YP_001393352.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]