SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U2JFZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0U2JFZ1
Domain Number 1 Region: 96-187
Classification Level Classification E-value
Superfamily Kringle-like 5.8e-33
Family Kringle modules 0.00014
Further Details:      
 
Domain Number 2 Region: 189-274
Classification Level Classification E-value
Superfamily Kringle-like 1.45e-32
Family Kringle modules 0.00013
Further Details:      
 
Domain Number 3 Region: 278-363
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-29
Family Kringle modules 0.0002
Further Details:      
 
Domain Number 4 Region: 366-446
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-29
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 5 Region: 21-106
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00000000000000129
Family Hairpin loop containing domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0U2JFZ1
Sequence length 447
Comment (tr|A0A0U2JFZ1|A0A0U2JFZ1_9TELE) Macrophage stimulating 1 {ECO:0000313|EMBL:ALO79319.1} OX=1095756 OS=allotetraploid Carassius auratus red var. x Cyprinus carpio. GN=mst1 OC=Cyprinidae; Cyprinidae hybrid sp..
Sequence
MIPLFFLTVLLLWPDTVHAFRSALNDFQRSEGRELVLKSWNVNRLTEFPGITLEDCAKRC
TESPECRAFNYEFRPSLVCKHLPLVGDNADVKRNVNCDLYEMKVYVRKCIVGKGEDYRGK
VSTTKSGRTCQQWWSKFPHDHRWTPSATNGLELNYCRNPDGDRIGPWCYTTDPEPRYESC
DIPQCKDEVCITCNGEDYRGQVDHTVSGKECQRWDQQYPHQHIYQPEKYPDKSLDDNYCR
NPDASPVPWCYTTDPTLERERCDIRKCPESPKHHSHSGYTTDCFQGRGEDYRGKVNETSS
GIPCQRWDAQKPHEHPFSPKTYECKGLEQNYCRNPDGSEAPWCFTSLSGMRTALCLQIKR
CADDIEAEDCYNEIGKNYRGVVRKTRKGILCQKWSVSTPHKTKINSKTHPEANLTDNYCR
NPDGDRHGPWCYTTDRKTEFDYCAIKQ
Download sequence
Identical sequences A0A0U2JFZ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]