SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U2UH26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0U2UH26
Domain Number - Region: 204-229,268-363
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00209
Family Pseudo ankyrin repeat 0.041
Further Details:      
 
Domain Number - Region: 44-171
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 0.00249
Family Hect, E3 ligase catalytic domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0U2UH26
Sequence length 385
Comment (tr|A0A0U2UH26|A0A0U2UH26_9VIRU) Uncharacterized protein {ECO:0000313|EMBL:ALR83686.1} OX=1766765 OS=Niemeyer virus. GN= OC=unclassified Mimiviridae.
Sequence
MSDFIFCYDSFVKGYLCEYIKEVNKKYRFYLTKKSYIKIIFKYISDLKYLVVNFNDSIKF
MKFIVKKDIHCDLKYHGHYKCQSLKNYATYFKYIVQNKCLENIRVFFGRFIPVVKLQSGI
SRVIDESPKKLFGNIVIDIEIIKTIFKYGPLSETESIIEYMLQTTPNLTDEFANDIIAIY
KRKIIKYLDTNNDDNTHINEKFHFPNFLIMAYKNDDVYLFNFINDDFFQIVDDLNNIDKT
KLNKKQLRTLELFNYKYKLNNQSINSIILPNLIRNDYVKLVKYFCPKIFKELITGFGNFS
LLNELILENILIYNNLEYMEIICECFEHTNPELVNKLLPSSRSVEMAQLLIDHGADYEAF
YYSNTFILSNISVKKHVAKLVREIL
Download sequence
Identical sequences A0A0G2YAD5 A0A0U2UH26 A0A165XAG1 A0A1E1EVF6 E3VYY3 W6GGY6
YP_003986669.1.55212 gi|311977549|ref|YP_003986669.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]