SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U2V4D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0U2V4D2
Domain Number 1 Region: 38-135
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 1.15e-33
Family Substrate-binding domain of HMG-CoA reductase 0.0000462
Further Details:      
 
Domain Number 2 Region: 1-44
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 0.0000000000000549
Family NAD-binding domain of HMG-CoA reductase 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0U2V4D2
Sequence length 135
Comment (tr|A0A0U2V4D2|A0A0U2V4D2_9SOLN) 3-hydroxy-3-methylglutaryl coenzyme A reductase 2 {ECO:0000313|EMBL:ALS09141.1} OX=42755 OS=Solanum spegazzinii. GN=HMG2 OC=Solaneae; Solanum.
Sequence
VSKGVQNVLDYLQNEYPDMDVIGISGNFCSDKKPSAVNWIEGRGKSVVCEAIITEEVVKK
VLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVFIATGQDPAQNIESSHCIT
MMEAVNDGKDLHISV
Download sequence
Identical sequences A0A0U2LH60 A0A0U2T9K8 A0A0U2V4D2 A0A0U2V8Q2 A0A0U2V8S3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]