SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U3A443 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0U3A443
Domain Number 1 Region: 253-363
Classification Level Classification E-value
Superfamily OmpA-like 1.31e-35
Family OmpA-like 0.00042
Further Details:      
 
Domain Number 2 Region: 27-188
Classification Level Classification E-value
Superfamily OMPA-like 4.19e-17
Family Outer membrane protein 0.022
Further Details:      
 
Domain Number 3 Region: 210-245
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000471
Family TSP type-3 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0U3A443
Sequence length 365
Comment (tr|A0A0U3A443|A0A0U3A443_XANOO) Uncharacterized protein {ECO:0000313|EMBL:ALS95710.1} KW=Complete proteome OX=64187 OS=Xanthomonas oryzae pv. oryzae. GN=AXO1947_15580 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MNKKILTAALLGGLAVAQAASAQEFDDRWYLTGSAGFNFQDRDRLTNDAPFVTLGLGKFV
SPNWSIDGELNYQNPNFDANQDLNWSQYGISFDLRRHFIQEGRGWNPYLLFGLGYQRSEE
EFDATPNPVSPGQRKDGNFAAKAGVGLQTTFDKRVAVRAELAYRADFNDQSVAAPRENWF
GDVLASVGVVIPLGPAPSTAPPPAPAPVAPSCADLDDDGDGVNNCDDKCPNSQPGQTIGP
DGCPVPVSIDLKGVNFDFNKSTLRPDAISILSEATEILKRYPDLKVEVAGHTDSKGTEAY
NQKLSERRATTVYDYLIKNGVDASRLVGPIGYGESRPIAPNTNPDGSDNPEGRAKNRRTE
LNVQN
Download sequence
Identical sequences A0A0M1KL56 A0A0U3A443
WP_024745687.1.1619 WP_024745687.1.34220 WP_024745687.1.89482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]