SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U3E3U1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0U3E3U1
Domain Number 1 Region: 4-86
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 2.46e-29
Family PG0164-like 0.0000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0U3E3U1
Sequence length 90
Comment (tr|A0A0U3E3U1|A0A0U3E3U1_EUBLI) Uncharacterized protein {ECO:0000313|EMBL:ALU14650.1} KW=Complete proteome OX=1736 OS=Eubacterium limosum. GN=ACH52_1871 OC=Eubacterium.
Sequence
MKELYEFDAMIKKVPDINGAYIEIPFDVKETFGCGRVKVHATFDGEAYDGSLVRMKTPCH
ILGIRKDIREKIGKQPGETVHVTIRERRNK
Download sequence
Identical sequences A0A0U3E3U1
WP_058694562.1.53489 WP_058694562.1.66621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]