SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U3NY02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0U3NY02
Domain Number 1 Region: 5-96
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 8.11e-20
Family PG0164-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0U3NY02
Sequence length 113
Comment (tr|A0A0U3NY02|A0A0U3NY02_9MICC) Uncharacterized protein {ECO:0000313|EMBL:ALV41743.1} KW=Complete proteome OX=121292 OS=Pseudarthrobacter sulfonivorans. GN=AU252_11755 OC=Pseudarthrobacter.
Sequence
MTSSYSFRAELWRYPDESGWHFLTLPVEVADDLREEAAVFRKGFGSVRVTAEISGCTWRT
SVFPDSKSGSYLLPVKKAVRDAAGISDGDEVAVRLAIQGEDEARTGERTSGTG
Download sequence
Identical sequences A0A0U3NY02
WP_058930868.1.54192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]