SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U3SXV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0U3SXV0
Domain Number 1 Region: 4-184
Classification Level Classification E-value
Superfamily VC0467-like 1.44e-60
Family VC0467-like 0.0000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0U3SXV0
Sequence length 184
Comment (tr|A0A0U3SXV0|A0A0U3SXV0_ACIJO) UPF0301 protein RZ95_15380 {ECO:0000256|HAMAP-Rule:MF_00758} KW=Complete proteome OX=1242245 OS=Acinetobacter johnsonii XBB1. GN=RZ95_15380 OC=Moraxellaceae; Acinetobacter.
Sequence
MSKQYLTHRCLIAPPDMADDFFANTVIYLARHDEEGAQGIIINRPSGLSVKELLNDLEIE
ADHVRPHDVLQGGPLRPEAGFVLHTGQPTWHSSIAVGENICITTSKDILDAIAHNEGVGR
YQIALGYASWTKNQLEDELARGDWLVCDADMDLIFNIPYDDRWDAAYKKLGLDRTWLSSE
IGHA
Download sequence
Identical sequences A0A0U3SXV0 A0A239RRP2
WP_010325762.1.101115 WP_010325762.1.26617 WP_010325762.1.28190 WP_010325762.1.87758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]