SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U4Z5P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0U4Z5P6
Domain Number 1 Region: 70-237
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.83e-21
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00023
Further Details:      
 
Domain Number 2 Region: 385-397,440-552
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000183
Family Pseudo ankyrin repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0U4Z5P6
Sequence length 635
Comment (tr|A0A0U4Z5P6|A0A0U4Z5P6_9EURO) Putative Phosphopentothenoylcysteine decarboxylase {ECO:0000313|EMBL:CEL05077.1} KW=Complete proteome; Reference proteome OX=454130 OS=Aspergillus calidoustus. GN=ASPCAL06198 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MAVGFVLGNTSSSSEVNGGGVKSMQGSEMDIDEPGKKAVENLNGPETLSNTLESHENTSL
PNRRKRLLISTDSEFVDNVLPSLVEHPGIELRFITDEPSALLSGTNKVPHYMDTVHSKTF
EKEIGARRWLKAKAAELCEWADMLLVAPVDAGTLGSMLSGLTNTLTLALLRGWMSTKPVL
LIPGMTISEWEHPLTERQCQEVHRFWPWIKIISPVLWKLNAPEELVQLPWAGLEQLHDML
EETLMLSLAQDAEDNTKALEPTTQAIVPLENTIPSNAAPIPSQASLRSSVPETKGIPFLP
LELWLNIFEDHLHDWEIAKAVGIPAKLPVPKEWQSHLLKMSAPASLEYTILRGSFAAIKK
RIDSLPRWKPLSDLACHLIFKFSRTDILSYLTENHLDLLWTTSRLTNIPYRASAIYRNPK
ILTWWRDAPALPNKEYIADAMDGASRAGFIDVLEWWRNSGLELRYTERALESASAEGRVD
VLDWWKKAAKASSLSRPIPLKVGKSVLLAAQSGRTASLAWWDASGIPYTHAESVARIAST
HGHVHVLDFWYKLKGSKMIFDCQVLVGPTKNGHDNVLEWWRRSGLRVEFKTCDIEEALED
ADPVSGAEERVRRWWAHNGLNLGVGTSEWMKTKVL
Download sequence
Identical sequences A0A0U4Z5P6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]