SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0U5FYG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0U5FYG2
Domain Number 1 Region: 2-159
Classification Level Classification E-value
Superfamily MAL13P1.257-like 1.26e-56
Family MAL13P1.257-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0U5FYG2
Sequence length 162
Comment (tr|A0A0U5FYG2|A0A0U5FYG2_9EURO) Putative DUF866 domain protein (AFU_orthologue AFUA_2G15510) {ECO:0000313|EMBL:CEL04592.1} KW=Complete proteome; Reference proteome OX=454130 OS=Aspergillus calidoustus. GN=ASPCAL05720 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MLSLILTAELSGVTDLRPQDTEESPYYYTFKVQCTSCREVHPNWVSFNRFEQHEIPGSRG
EANFVWKCKLCQRTHSASILAAPKAYEAEAEGKKKGQKIIDIECRGLEFTEFKADGEWEA
KGIESSTPFTGIELLEGEWYDYDEKAGDEVAIKEISWEVGRA
Download sequence
Identical sequences A0A0U5FYG2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]