SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V0GA48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V0GA48
Domain Number 1 Region: 111-223
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 1.83e-32
Family Elongation factor TFIIS domain 2 0.0067
Further Details:      
 
Domain Number 2 Region: 1-93
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.31e-25
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00019
Further Details:      
 
Domain Number 3 Region: 242-290
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 9.07e-17
Family Transcriptional factor domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0V0GA48
Sequence length 292
Comment (tr|A0A0V0GA48|A0A0V0GA48_TRIDM) Putative transcription elongation factor tfiis/cofactor of enhancer-binding protein sp1 {ECO:0000313|EMBL:JAP04271.1} OX=72491 OS=Triatoma dimidiata (Kissing bug). GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Triatoma.
Sequence
MSVEEDVMRIQKKLTKMTSGDGQEQALDLLKALQNLPVNLEILTKTRIGMTVNALRKSSN
DDEVISLSKTLIKNWKKFLGPNMGKESTPTSSTKKPANKPTIKEERKEEEVKKDKLKHTS
FPPANTTDAVRLKCRELLVSALKTDLNDSFEGCATPEELAEELEEAIFQEFKNTDNRYKN
RVRSRVSNLKDTKNPQLRTNFLCGALTANKLAVMTAEEMASDEMKALRNKFVKESIDDAQ
LATVQGTKTDLLKCAKCKKRNCTYNQVQTRSADEPMTTFVMCNECGNRWKFC
Download sequence
Identical sequences A0A0V0GA48

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]