SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V0J293 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V0J293
Domain Number 1 Region: 62-168
Classification Level Classification E-value
Superfamily GINS helical bundle-like 1.15e-26
Family PSF2 C-terminal domain-like 0.00039
Further Details:      
 
Domain Number 2 Region: 1-60
Classification Level Classification E-value
Superfamily PriA/YqbF domain 4.25e-21
Family PSF2 N-terminal domain-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V0J293
Sequence length 196
Comment (tr|A0A0V0J293|A0A0V0J293_SCHSO) DNA replication complex GINS protein PSF2 {ECO:0000256|PIRNR:PIRNR028998} OX=70667 OS=Schistocephalus solidus (Tapeworm). GN=TR112449 OC=Diphyllobothriidea; Diphyllobothriidae; Schistocephalus.
Sequence
MNPNELEFLAENDLIQIIPRFKMEAIDLIEHFVGPFQPNIPCEVPLWLAIHLRRQQKCRI
IPPTWLCVTSLTEFKEAEELESGCTKPPHPHYTEVATLLLQHAPDDLPDQEAVRTLIKDL
WDARVGKFVSSVNQFISSGAATARVSQLTCLELATVRNILANSLDQLAILRQKVAERSSE
IPSQSQSLLGSTGLTE
Download sequence
Identical sequences A0A0V0J293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]