SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V0R2D4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V0R2D4
Domain Number 1 Region: 73-251
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-37
Family Nucleotide and nucleoside kinases 0.00044
Further Details:      
 
Domain Number 2 Region: 29-65
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000602
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V0R2D4
Sequence length 299
Comment (tr|A0A0V0R2D4|A0A0V0R2D4_PSEPJ) p-loop containing nucleoside triphosphate hydrolase {ECO:0000313|EMBL:KRX08660.1} KW=Complete proteome; Reference proteome OX=266149 OS=Pseudocohnilembus persalinus (Ciliate). GN=PPERSA_07472 OC=Pseudocohnilembus.
Sequence
MNPDQFDSELKTYYTKIKTEIKQQHQDYLKNHPELREILNDFLSQTLLEKPKDVYNYARD
YFSYFNIEEDLVKYQPLIITGPYGSGKSTLIKKLIETYPNIFQRSISYTTRAALPNETHG
EEYYFVSKNEFTKEIQKNQFLQYEVKQDNEYFGTHLGKLNAIVNNGKIAILELDLDAAKN
IIEQNPSYKFISISAPFEQCRQRIEQRTDLDNEQLKQKLEISKSEIEKQKTSNFKIIENK
QEIQIAFEKLVNVNSVDSQQQNEKDEQIAKLQAQNTKLQYRIDHLVRNYNDLRSQAQKK
Download sequence
Identical sequences A0A0V0R2D4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]