SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V0RTG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V0RTG4
Domain Number 1 Region: 61-169
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000177
Family Txnl5-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0V0RTG4
Sequence length 175
Comment (tr|A0A0V0RTG4|A0A0V0RTG4_9BILA) Thioredoxin domain-containing protein 17 {ECO:0000313|EMBL:KRX17707.1} KW=Complete proteome; Reference proteome OX=6336 OS=Trichinella nelsoni. GN=T07_1390 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MKSTCSILFLCLVSFVSLYYCNPSIQSKYATKAPSTPESVTVRQRNRINPELRYVSTCRS
LRQLASQVHSSYNIYVIFCGTRNQWGYSWCPMCTALEHYVKQLAYYLPEETLLIYVEVGT
LEQFQDESNCFRKDEVVKLRRVPTLMNWRTGERLVENESVDFAKLMKFMGLEKLH
Download sequence
Identical sequences A0A0V0RTG4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]