SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V0TXF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V0TXF0
Domain Number 1 Region: 16-55
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0V0TXF0
Sequence length 206
Comment (tr|A0A0V0TXF0|A0A0V0TXF0_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KRX43716.1} KW=Complete proteome; Reference proteome OX=144512 OS=Trichinella murrelli. GN=T05_9972 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
LSYVQMPQSAVDLENAIPPGLRPLLVALAREVLCYRPRDICSFCALFFQTLLQVREEVHD
NPLNNKEMYAAFQTTLTKEARRLGLQSSDDKTAAMESVESKATIQQNNSMQGDSDPVKIS
SATKIQANIRGYLTRKHLQQEGIKIYHNHNEILHPEQEAAVMIQASVRSFLTRKHLEAQG
VLYPRKASSQNQQQNGNGQDAISGTV
Download sequence
Identical sequences A0A0V0TXF0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]