SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V1D2A6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1D2A6
Domain Number 1 Region: 3-105
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.000000000000012
Family Tubulin chaperone cofactor A 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V1D2A6
Sequence length 118
Comment (tr|A0A0V1D2A6|A0A0V1D2A6_TRIBR) Tubulin-specific chaperone A {ECO:0000256|RuleBase:RU364030} KW=Complete proteome; Reference proteome OX=45882 OS=Trichinella britovi (Parasitic roundworm). GN=T03_3051 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MANRRRLFIQTNVVSRLIKDQRLYLQEFHSYQAQLQQLRHNNEDPDAILKMSKLVDESLM
MVNDSAARLNNACKELCDQVKDLAALGDEEDVALSDRAKRILEEAQTVISSFVPPDPM
Download sequence
Identical sequences A0A0V0SFR5 A0A0V0TCG9 A0A0V0WMD1 A0A0V0ZJ44 A0A0V1D2A6 A0A0V1L1D6 A0A0V1PAZ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]