SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V1F1G2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1F1G2
Domain Number 1 Region: 57-100
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000654
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0V1F1G2
Sequence length 151
Comment (tr|A0A0V1F1G2|A0A0V1F1G2_TRIPS) cAMP-dependent protein kinase type I-alpha regulatory subunit {ECO:0000313|EMBL:KRY79759.1} KW=Complete proteome OX=6337 OS=Trichinella pseudospiralis (Parasitic roundworm). GN=T4A_1810 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MVILCGQRRKKEDILKKVQRICFHFQSCRYGFCSDSIFGKGNDDGLVMSHQSAWARLCED
YLERHNVSDLIKRALVRLCIAQPDDPVAFLSHYFQLLEKGEDLSLHASLVRRTILLKNGF
PEGEPLRKWFRHVSRSDALFEKRVSINCEPH
Download sequence
Identical sequences A0A0V1F1G2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]