SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V1F979 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1F979
Domain Number 1 Region: 32-61,169-338
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.26e-58
Family G proteins 0.000000026
Further Details:      
 
Domain Number 2 Region: 61-171
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 2.75e-31
Family Transducin (alpha subunit), insertion domain 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0V1F979
Sequence length 344
Comment (tr|A0A0V1F979|A0A0V1F979_TRIPS) Guanine nucleotide-binding protein G(Q) subunit alpha {ECO:0000313|EMBL:KRY82713.1} KW=Complete proteome OX=6337 OS=Trichinella pseudospiralis (Parasitic roundworm). GN=T4D_9008 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MTCCSSEEAREQRRINREIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMKIIHGSG
YSDEDKRGLIRVVFQNIFMAMQAMIRAMDTLKVPYGDPSNEEKAVIIRAIDYESVTTFEE
PYVSYIRDLWNDKGILEVYDRRRDYLSDIDRISQPNYLPTEQDILRVRVPTTGIIEYPFD
LEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDNENRMEESKALF
RTIITYPWFQNSSVILFLNKKDLLEEKIMTSHLVDYFPEYDGPPRDAIAAREFILKTFVD
LNPDADKIIYSHFTCATDTENIRFVFAAVRDTILQHNLKEYNLV
Download sequence
Identical sequences A0A0V1F979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]