SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V1HZQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1HZQ4
Domain Number 1 Region: 161-316
Classification Level Classification E-value
Superfamily Functional domain of the splicing factor Prp18 4.45e-47
Family Functional domain of the splicing factor Prp18 0.0005
Further Details:      
 
Domain Number 2 Region: 75-109
Classification Level Classification E-value
Superfamily PRP4-like 0.00000000667
Family PRP4-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0V1HZQ4
Sequence length 328
Comment (tr|A0A0V1HZQ4|A0A0V1HZQ4_9BILA) Pre-mRNA-splicing factor 18 {ECO:0000313|EMBL:KRZ15109.1} KW=Complete proteome; Reference proteome OX=268475 OS=Trichinella zimbabwensis. GN=T11_2261 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MDSLKAELERKRNFLKTFKEKEPSKKFFRRGEVTAKSAELKQDEEESGSSADRKDDATND
CCEEENVDFDLSKIAETVDRLRERNEPVRMFGESNADVIKRLSRLENEDTETKCSEDFER
NQKPYLKDFSRENKSEENVDVYEDDIDMTMSDLMEMSKKLEKGNVQLDCELVHNFFSFIM
KKWAIELNSRTDEVKRTANGKRAASTHSQTREYLQPLFRQLKFYSVAGDIREHLVNITIC
LLNRNYIEANNHYMQMAIGNAPWPVGVTASGIHKRPGSEKLYVRNVAHVLNDETQRKYIQ
GLKRLMSRCQIFYPTDPSRSVEFGGVTL
Download sequence
Identical sequences A0A0V1HZQ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]