SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V1JB43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1JB43
Domain Number 1 Region: 18-66
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000693
Family Elafin-like 0.0016
Further Details:      
 
Domain Number 2 Region: 75-119
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000445
Family Elafin-like 0.0029
Further Details:      
 
Domain Number 3 Region: 179-226
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000536
Family Elafin-like 0.0021
Further Details:      
 
Domain Number 4 Region: 231-275
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000144
Family Elafin-like 0.0026
Further Details:      
 
Domain Number 5 Region: 129-172
Classification Level Classification E-value
Superfamily Elafin-like 0.000000392
Family Elafin-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V1JB43
Sequence length 336
Comment (tr|A0A0V1JB43|A0A0V1JB43_TRIPS) WAP four-disulfide core domain protein 3 {ECO:0000313|EMBL:KRZ31781.1} KW=Complete proteome OX=6337 OS=Trichinella pseudospiralis (Parasitic roundworm). GN=T4C_11145 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MEKRFAIICFTLFSSLNFVFSEKPGICPPVLKSTVEQRVDNCWKDYDCSGEKKCCQTVLG
NGCLFPLPEPSIGETKIGICPKFAGFYKTYRINKCINDKNCIGMYKCCDTAFGKRCLLPQ
LQSVKVESVQSTGICPPMISRKLPHAFDRCQDDLQCGKERKCCDTVNGKMCLLTENTNNI
NVERAGICPDYSPGTGMLVYRCLYDADCPDLQKCCNTQEGKDCILPNKAMDYMKPGACPL
YIPKEQNFNFQKCTTDNDCPGTSKCCNNKEEKVCLIAEMECNTKMMYIYIYISCIFKIYY
FIFQILKNLETVLHFMDRRTMWMCFISAMMIMIVQK
Download sequence
Identical sequences A0A0V1JB43

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]