SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V1KY01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1KY01
Domain Number 1 Region: 739-798
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000324
Family VWC domain 0.0031
Further Details:      
 
Domain Number 2 Region: 906-967
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000126
Family VWC domain 0.011
Further Details:      
 
Domain Number 3 Region: 807-881
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000429
Family Fibronectin type I module 0.077
Further Details:      
 
Domain Number 4 Region: 111-188
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000628
Family VWC domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V1KY01
Sequence length 979
Comment (tr|A0A0V1KY01|A0A0V1KY01_9BILA) Chordin {ECO:0000313|EMBL:KRZ51861.1} KW=Complete proteome; Reference proteome OX=6335 OS=Trichinella nativa. GN=T02_3878 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MHRQKRFKQYNWKMLTAPVGFLEKSGSSRSLSLSWSAKTTVMAQYFNSAISSAIVTLLLI
NSFFHCIVILTVGGENTIDIVKPMIGLFPLKEHVDVRQKFLSKSNYTTINLGCYFGGKKY
ELDEEWNPDLGPPFGIMVCIRCKCIPIQKKKRIVGRVTCRKFVNLCQKPPCANPITLSGE
CCKTCPGMEVVPVDVFGSSHTQANDFHWNQGYHEFMALMTGPICGMSRSTGVGRAYITLD
RNMLHVSVYFERLEEIPITVQILDVNSMILYEVFLKQTDIEQKVCIVWSEMPRIYVHALK
RGELQIVLTTKRRPEGIIGGPIIKHKMLSREVYNVLLFPSSYQAGYGGVAVVDIHGNGDQ
LAIVGWLNSNVSVERKVVPNVIFISLEKNDGRHRTSKTIRGKLTHLKNSSFMFEVSIHLN
AVEQRWLSRGHLLMTLAGEQLFPKHFVGLFMPKQSCDVYQAVLSENFNMTTQEPNGTAGY
AIIEILKDSAAKYKVKVADFKEEQLYGFTIERETRQNRKRVIAESSSPKEFLNGLTFGTL
THFLNVRNLQLLFREKLMFEMADEDGNSLLRGPIRRVLHNDAVTLTNNLPTLLAGNGFKK
RVNTSAAGIAWFATVDVEETCLLYYAVTLSSLPALKSEEITMNLCNRVNEKCLLELKNIK
SFNTDLKEIYLYGHVPLAPLAVLNALADEQLYLNISTLSHPTGEIAGNISIENNCKPRRL
QRDSFVAEDQAVNMLMRTNDCIYHEVTYNDGSSWPALHEECTTCSCQRGNIKCDPILCPQ
ADCADPVKQPGECCPVCQMSDSNTSVEKGCFWTADNKWHAAGSSWHPYLPPFGYSRCALC
TCLHSTSEVMCRKTTCPTPACPPNLRYRENALDCCPKCKDVVQRTEITEQVMPVTSSSLQ
GDASPGSCFFNNQWHQDKSVFAPKILHLGSLKCITCKCQNGRVFCQRPSCSSLPCNDRSR
INGCCPSSVASAEGGSRDR
Download sequence
Identical sequences A0A0V1KY01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]