SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V1L509 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1L509
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 3.79e-19
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0016
Further Details:      
 
Domain Number 2 Region: 79-159
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000024
Family Cold shock DNA-binding domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0V1L509
Sequence length 197
Comment (tr|A0A0V1L509|A0A0V1L509_9BILA) DNA-directed RNA polymerase III subunit RPC8 {ECO:0000313|EMBL:KRZ54589.1} KW=Complete proteome; Reference proteome OX=6335 OS=Trichinella nativa. GN=T02_16302 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MFKLCKFRQIIRIPPHRFGEDVVKYLEIKIGEMFINKVILNYGLCICVHSIEEIGDSITL
PGDGGAHTEVTWNMIVFHPNIGEVLKGEISKCDSTGVSVTMTFFEDIFIPKEYLPQPSKF
LQNEQIWSWQYEVDDGFAELFLEPGSKVRFRVIDEVFKDIPTQVSDDGQENTNQKCYEIY
GAMNDTGLGCISWWNAS
Download sequence
Identical sequences A0A0V0UF45 A0A0V0VD79 A0A0V1L509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]